PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA07G26440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 476aa    MW: 50859.4 Da    PI: 5.4725
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA07G26440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.56.9e-39104163261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rn+PvG+grrk+k+s
  ONIVA07G26440.1 104 PDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKSCQRYWTAGGSMRNLPVGAGRRKSKSS 163
                      7899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31101161IPR003851Zinc finger, Dof-type
PfamPF027011.1E-31106162IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.528108162IPR003851Zinc finger, Dof-type
PROSITE patternPS013610110146IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MDDLAAASPP HPPPPPPESH VPPPPQTPEK DSCEDTGDMR ISEEKPCTDQ ELDADQMNSS  60
SFNSSSECEN QTPSNDEMTG SESKSEAAQT EGGGSSEEKV LKKPDKILPC PRCNSMDTKF  120
CYYNNYNINQ PRHFCKSCQR YWTAGGSMRN LPVGAGRRKS KSSTANYRSI LITGSNLAAP  180
AGDAPLYQLS IKGDQTATAV KFAPDSPLCN SMASVLKIGE QSKNAKPTST AQPRNGETQT  240
CPASGTTSDS PRNEPVNVAV SGHQNGIVGH SGVPPMHPIP CFPGPPFVYP WSPAWNGIPA  300
MAPPVCTAPA EPANSSDNGS TASVQWSMPP VMPVPGYFPV IPSSVWPFIS PWPNGAWSSP  360
WIQPNCSVSA SSPTSTSTCS DNGSPVLGKH SRDSKPQGDD KAEKNLWIPK TLRIDDPDEA  420
AKSSIWTTLG IEPGDRSMFR SFQSKPESRE QISGAARVLQ ANPAALSRSQ SFQETT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1040950.0AK104095.1 Oryza sativa Japonica Group cDNA clone:001-032-E07, full insert sequence.
GenBankAY2244300.0AY224430.1 Oryza sativa (japonica cultivar-group) isolate 20587 AOBP-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647890.10.0PREDICTED: cyclic dof factor 2
TrEMBLA0A0E0I5U30.0A0A0E0I5U3_ORYNI; Uncharacterized protein
TrEMBLB8B6450.0B8B645_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA023697-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-81cycling DOF factor 2